DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK2

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001326044.1 Gene:CPK2 / 820235 AraportID:AT3G10660 Length:646 Species:Arabidopsis thaliana


Alignment Length:163 Identity:46/163 - (28%)
Similarity:75/163 - (46%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSG 111
            ||::..|.....|.||.:.|:.:|.|.|..:..||...|::..|.::.|.||..:....|.|.||
plant   477 LRVIAESLSEEEIAGLKQMFKMIDADNSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNSG 541

  Fly   112 SINMTEFLLKLRPPMPQSRLNIIDQ------AFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGE 170
            :|:..||:      .....||.|::      ||:..|:||.|.||..:|:           |:.|
plant   542 TIDYKEFI------AATLHLNKIEREDHLFAAFSYFDKDESGFITPDELQ-----------QACE 589

  Fly   171 K--SEDEILTDFLHNFEGGRGNLDGKITREEFV 201
            :  .||..:.:.:.:.:..:   ||:|...|||
plant   590 EFGVEDARIEEMMRDVDQDK---DGRIDYNEFV 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 18/56 (32%)
EFh 64..119 CDD:238008 17/54 (31%)
EFh 97..154 CDD:238008 20/62 (32%)
EF-hand_7 98..158 CDD:290234 20/65 (31%)
EF-hand_7 134..204 CDD:290234 20/76 (26%)
CPK2NP_001326044.1 PspC_subgroup_2 <45..>159 CDD:411408
STKc_CAMK 185..443 CDD:270687
PTZ00184 480..622 CDD:185504 44/160 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.