DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and MSS3

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_565996.1 Gene:MSS3 / 818931 AraportID:AT2G43290 Length:215 Species:Arabidopsis thaliana


Alignment Length:157 Identity:36/157 - (22%)
Similarity:70/157 - (44%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPM 126
            |.|.|:..|.:|...:.:||....:.:.|:.:.::::.||....|.:|.|.:::.||        
plant    66 LKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDIDEF-------- 122

  Fly   127 PQSRLNIIDQ--------------AFNKMDRDEDGVITIQDLKNVYS---VKEHPKYQSGEKSED 174
            .....:|:|:              |||..|:|.||.||:::||:|.:   :|:.......:|...
plant   123 ESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGCKKMIM 187

  Fly   175 EILTDFLHNFEGGRGNLDGKITREEFV 201
            ::..|.           ||::..:||:
plant   188 QVDADG-----------DGRVNYKEFL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/56 (25%)
EFh 64..119 CDD:238008 13/54 (24%)
EFh 97..154 CDD:238008 18/70 (26%)
EF-hand_7 98..158 CDD:290234 20/73 (27%)
EF-hand_7 134..204 CDD:290234 20/85 (24%)
MSS3NP_565996.1 PTZ00184 64..206 CDD:185504 36/157 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.