DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK14

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_181717.3 Gene:CPK14 / 818786 AraportID:AT2G41860 Length:530 Species:Arabidopsis thaliana


Alignment Length:166 Identity:35/166 - (21%)
Similarity:73/166 - (43%) Gaps:22/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFL---LKLRPPMP 127
            |:.||......:...|...|::..|:.|.:::|:.:....|.|..|.:::.||:   :.:|....
plant   364 FQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDVDKDGYLDVNEFVAISVHIRKLGN 428

  Fly   128 QSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLD 192
            ...|.   :||...|:::.|.|.|::|::..:       ...:.:.:|::...:.:.:   .|.|
plant   429 DEHLK---KAFTFFDKNKSGYIEIEELRDALA-------DDVDTTSEEVVEAIILDVD---TNKD 480

  Fly   193 GKITREEFVNYYAT------ISASIDNDMFFDLMMR 222
            |||:.:||.....|      .|.....|:|..|.::
plant   481 GKISYDEFATMMKTGTDWRKASRQYSRDLFKCLSLK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 12/52 (23%)
EFh 64..119 CDD:238008 12/52 (23%)
EFh 97..154 CDD:238008 14/59 (24%)
EF-hand_7 98..158 CDD:290234 15/62 (24%)
EF-hand_7 134..204 CDD:290234 15/69 (22%)
CPK14NP_181717.3 STKc_CAMK 53..311 CDD:270687
FRQ1 351..493 CDD:227455 30/141 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.