DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CRK1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_181647.1 Gene:CRK1 / 818713 AraportID:AT2G41140 Length:576 Species:Arabidopsis thaliana


Alignment Length:134 Identity:28/134 - (20%)
Similarity:51/134 - (38%) Gaps:32/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLREIRTKGWSLKNPNCDLYTLEANMASQALRELTDG-EDKDPITKLRLL-CLSRGATGILGLGR 64
            :|||    .::|..|:.:.|....|..:..|:..||. :|......:.:: ||.           
plant   431 YLRE----QFTLLGPSKNGYISMQNYKTAILKSSTDAMKDSRVFDFVHMISCLQ----------- 480

  Fly    65 AFRAMDDDGSKALNEEEFITGIRDT----GLDVSEEEIKQMFATFDEDGSGSINMTEFL--LKLR 123
                     .|.|:.|||.......    .::..|:..::.:..|::||:..|.:.|..  |.|.
plant   481 ---------YKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFEKDGNRPIMIEELASELGLG 536

  Fly   124 PPMP 127
            |.:|
plant   537 PSVP 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/60 (18%)
EFh 64..119 CDD:238008 11/58 (19%)
EFh 97..154 CDD:238008 9/33 (27%)
EF-hand_7 98..158 CDD:290234 9/32 (28%)
EF-hand_7 134..204 CDD:290234
CRK1NP_181647.1 STKc_CAMK 122..384 CDD:270687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.