DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK20

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_181425.1 Gene:CPK20 / 818476 AraportID:AT2G38910 Length:583 Species:Arabidopsis thaliana


Alignment Length:210 Identity:53/210 - (25%)
Similarity:87/210 - (41%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLREIRTKGWSLKNPNCDLYTLEANMASQALRELTDGEDKDPITK--LRLLCLSRGATGILGLG 63
            |...|:....|:    ..|...|:..:.|..|..|......:.:.|  ::::..|.....|.||.
plant   381 MTTHEVLCHPWA----RVDGVALDKPLDSAVLSRLQQFSAMNKLKKIAIKVIAESLSEEEIAGLK 441

  Fly    64 RAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQ 128
            ..|:.:|.|.|..:..||...|:...|.|:.:.||..:....|.|.||:|:..||:..:      
plant   442 EMFKMIDTDNSGHITLEELKKGLDRVGADLKDSEILGLMQAADIDNSGTIDYGEFIAAM------ 500

  Fly   129 SRLNIIDQ------AFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGG 187
            ..||.|::      ||:..|:|..|.||..:|:....     ::...:...|:||.      |..
plant   501 VHLNKIEKEDHLFTAFSYFDQDGSGYITRDELQQACK-----QFGLADVHLDDILR------EVD 554

  Fly   188 RGNLDGKITREEFVN 202
            :.| ||:|...|||:
plant   555 KDN-DGRIDYSEFVD 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 18/56 (32%)
EFh 64..119 CDD:238008 17/54 (31%)
EFh 97..154 CDD:238008 19/62 (31%)
EF-hand_7 98..158 CDD:290234 19/65 (29%)
EF-hand_7 134..204 CDD:290234 20/75 (27%)
CPK20NP_181425.1 STKc_CAMK 134..391 CDD:270687 2/9 (22%)
FRQ1 432..572 CDD:227455 43/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.