DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK16

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_179379.1 Gene:CPK16 / 816299 AraportID:AT2G17890 Length:571 Species:Arabidopsis thaliana


Alignment Length:196 Identity:44/196 - (22%)
Similarity:73/196 - (37%) Gaps:50/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGI-RDTGLDVS 94
            |||.|....|::.:..||               ..|.|:|.|.:..::.||....: :|....:.
plant   400 ALRALATTLDEEELADLR---------------DQFDAIDVDKNGVISLEEMRQALAKDHPWKLK 449

  Fly    95 EEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQ------------AFNKMDRDEDG 147
            :..:.::....|.:..|.::..||:      .....:|.:::            ||.|.|.|.||
plant   450 DARVAEILQAIDSNTDGFVDFGEFV------AAALHVNQLEEHDSEKWQQRSRAAFEKFDIDGDG 508

  Fly   148 VITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASID 212
            .||.::|          :..:|.|...|.|.:     |....| ||||:.:||.....|.|....
plant   509 FITAEEL----------RMHTGLKGSIEPLLE-----EADIDN-DGKISLQEFRRLLRTASIKSR 557

  Fly   213 N 213
            |
plant   558 N 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 10/57 (18%)
EFh 64..119 CDD:238008 10/55 (18%)
EFh 97..154 CDD:238008 14/68 (21%)
EF-hand_7 98..158 CDD:290234 15/71 (21%)
EF-hand_7 134..204 CDD:290234 22/81 (27%)
CPK16NP_179379.1 STKc_CAMK 107..367 CDD:270687
S_TKc 108..368 CDD:214567
PTZ00184 404..549 CDD:185504 38/181 (21%)
EFh 415..476 CDD:238008 13/81 (16%)
EFh 496..550 CDD:238008 22/69 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.