Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_179379.1 | Gene: | CPK16 / 816299 | AraportID: | AT2G17890 | Length: | 571 | Species: | Arabidopsis thaliana |
Alignment Length: | 196 | Identity: | 44/196 - (22%) |
---|---|---|---|
Similarity: | 73/196 - (37%) | Gaps: | 50/196 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 ALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGI-RDTGLDVS 94
Fly 95 EEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQ------------AFNKMDRDEDG 147
Fly 148 VITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASID 212
Fly 213 N 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 10/57 (18%) |
EFh | 64..119 | CDD:238008 | 10/55 (18%) | ||
EFh | 97..154 | CDD:238008 | 14/68 (21%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 15/71 (21%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 22/81 (27%) | ||
CPK16 | NP_179379.1 | STKc_CAMK | 107..367 | CDD:270687 | |
S_TKc | 108..368 | CDD:214567 | |||
PTZ00184 | 404..549 | CDD:185504 | 38/181 (21%) | ||
EFh | 415..476 | CDD:238008 | 13/81 (16%) | ||
EFh | 496..550 | CDD:238008 | 22/69 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |