DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and CAMK4

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_001310303.1	Gene:	CAMK4 / 814	HGNCID:	1464	Length:	473	Species:	Homo sapiens

Alignment Length:	89	Identity:	21/89 - (23%)
Similarity:	36/89 - (40%)	Gaps:	28/89 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    72 DGS---KALNEEEFITG--------------------IRDTGLDVSEEEIKQMFATFDEDGSGSI 113
            ||:   ||:.|.|.|.|                    .:..|.|::.||..:|.....|||   |
Human   364 DGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDG---I 425

  Fly   114 NMTEFLLKLRPPMPQSRLNIIDQA 137
            .:.:  |:|...:.:.:|..:::|
Human   426 KVAD--LELEEGLAEEKLKTVEEA 447

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	17/69 (25%)
		EFh	64..119	CDD:238008	17/69 (25%)
		EFh	97..154	CDD:238008	10/41 (24%)
		EF-hand_7	98..158	CDD:290234	9/40 (23%)
		EF-hand_7	134..204	CDD:290234	1/4 (25%)
CAMK4	NP_001310303.1	STKc_CaMKIV	42..335	CDD:270987
		Pkinase	46..300	CDD:278497
		Autoinhibitory domain	305..321
		PP2A-binding	306..323
		Calmodulin-binding. /evidence=ECO:0000255	322..341
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	341..368		2/3 (67%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	445..473		1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900