DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CAMK4

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001310303.1 Gene:CAMK4 / 814 HGNCID:1464 Length:473 Species:Homo sapiens


Alignment Length:89 Identity:21/89 - (23%)
Similarity:36/89 - (40%) Gaps:28/89 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DGS---KALNEEEFITG--------------------IRDTGLDVSEEEIKQMFATFDEDGSGSI 113
            ||:   ||:.|.|.|.|                    .:..|.|::.||..:|.....|||   |
Human   364 DGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDG---I 425

  Fly   114 NMTEFLLKLRPPMPQSRLNIIDQA 137
            .:.:  |:|...:.:.:|..:::|
Human   426 KVAD--LELEEGLAEEKLKTVEEA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 17/69 (25%)
EFh 64..119 CDD:238008 17/69 (25%)
EFh 97..154 CDD:238008 10/41 (24%)
EF-hand_7 98..158 CDD:290234 9/40 (23%)
EF-hand_7 134..204 CDD:290234 1/4 (25%)
CAMK4NP_001310303.1 STKc_CaMKIV 42..335 CDD:270987
Pkinase 46..300 CDD:278497
Autoinhibitory domain 305..321
PP2A-binding 306..323
Calmodulin-binding. /evidence=ECO:0000255 322..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..368 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..473 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.