DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and stk17al

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001071197.1 Gene:stk17al / 777621 ZFINID:ZDB-GENE-061103-427 Length:358 Species:Danio rerio


Alignment Length:231 Identity:45/231 - (19%)
Similarity:82/231 - (35%) Gaps:50/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLREIRTKGWSLK----NPNCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGL 62
            |||: |.||...:    |....|.:.|||.....|.|:.:       |...::.:...|.|    
Zfish    55 FLRK-RRKGQDCRGDILNEIAVLESAEANPYVVGLHEVYE-------TTSEIILVLECAAG---- 107

  Fly    63 GRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMP 127
            |..|.....|..:|..|::.|...|...:.||         ...::....:::....:.|....|
Zfish   108 GEIFNQCVADNDEAFTEKDVIRLARQILMGVS---------CLHQNNIVHLDLKPQNILLTSAQP 163

  Fly   128 QSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDE------------ILTDF 180
            ...:.|:|..   :.|..|.|..::::...      |:|.:.|..:.|            :||..
Zfish   164 LGDIRIVDFG---LSRRVDSVSEVREILGT------PEYVAPEILDYEPISTATDMWSIGVLTYV 219

  Fly   181 LHNFEGGRGNLDGKITREEFVNYYATISASIDNDMF 216
            :..   |.....|:..:|.|:| .:.::.....|:|
Zfish   220 MLT---GESPFLGEEKQETFLN-ISQVNVDYSQDVF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 9/56 (16%)
EFh 64..119 CDD:238008 8/54 (15%)
EFh 97..154 CDD:238008 7/56 (13%)
EF-hand_7 98..158 CDD:290234 7/59 (12%)
EF-hand_7 134..204 CDD:290234 15/81 (19%)
stk17alNP_001071197.1 PKc_like 16..285 CDD:304357 45/231 (19%)
S_TKc 27..285 CDD:214567 45/231 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.