DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Efcab6

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006521594.2 Gene:Efcab6 / 77627 MGIID:1924877 Length:1536 Species:Mus musculus


Alignment Length:183 Identity:36/183 - (19%)
Similarity:66/183 - (36%) Gaps:55/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEF------LLKL 122
            |..:..|.|....::..||:..:....||:|.||.:|:...:|...:|.....:|      |||.
Mouse  1365 RECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKA 1429

  Fly   123 RPPMPQSRLNI---------------------------------IDQAFNKMDRDEDGVITIQDL 154
            :......|:.|                                 :.::|...|::..|::::.|.
Mouse  1430 KETSLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADF 1494

  Fly   155 KNV---YSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYY 204
            :.|   ||:         ..||:|    |.|..|....:|..||:..:|:..:
Mouse  1495 RKVLRQYSI---------NLSEEE----FFHVLEYYDKSLSSKISYNDFLRAF 1534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/60 (23%)
EFh 64..119 CDD:238008 14/60 (23%)
EFh 97..154 CDD:238008 13/95 (14%)
EF-hand_7 98..158 CDD:290234 14/101 (14%)
EF-hand_7 134..204 CDD:290234 17/72 (24%)
Efcab6XP_006521594.2 FRQ1 119..285 CDD:227455
FRQ1 338..501 CDD:227455
EFh_PEF 787..>952 CDD:355382
EF-hand motif 787..823 CDD:320054
EF-hand motif 828..889 CDD:320054
EF-hand motif 890..922 CDD:320054
EFh_PI-PLC 894..1004 CDD:333715
EF-hand motif 894..922 CDD:320029
EF-hand_7 898..952 CDD:372618
EF-hand motif 929..954 CDD:320029
EF-hand_11 1197..1301 CDD:370222
PTZ00183 1364..1532 CDD:185503 36/179 (20%)
EF-hand_7 1474..1534 CDD:372618 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.