DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Capsl

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_083617.2 Gene:Capsl / 75568 MGIID:1922818 Length:208 Species:Mus musculus


Alignment Length:202 Identity:98/202 - (48%)
Similarity:144/202 - (71%) Gaps:3/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRD 88
            :..||.|:.::|:..  .|||.:|||.||:||:.||.||||.||.|||:.::.|:.:||:.|:.|
Mouse     8 DREMAIQSKKKLSTA--TDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLND 70

  Fly    89 TGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD 153
            ..:.:.:||.:::|..||.||||:|:..||||.|||||.::|..:|.:||.|:|:..||||||:|
Mouse    71 YAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIED 135

  Fly   154 LKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFD 218
            |:.||:.|.|||||:||.:|:::...||.||:... :.||.:|.|||:||||.:|||||.|::|.
Mouse   136 LREVYNAKHHPKYQNGEWTEEQVFRKFLDNFDSPY-DKDGLVTPEEFMNYYAGVSASIDTDVYFI 199

  Fly   219 LMMRRAY 225
            :||..|:
Mouse   200 IMMTTAW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 24/56 (43%)
EFh 64..119 CDD:238008 22/54 (41%)
EFh 97..154 CDD:238008 30/56 (54%)
EF-hand_7 98..158 CDD:290234 31/59 (53%)
EF-hand_7 134..204 CDD:290234 35/69 (51%)
CapslNP_083617.2 EF-hand_7 44..101 CDD:290234 24/56 (43%)
EFh 46..101 CDD:238008 22/54 (41%)
EFh 79..138 CDD:238008 32/58 (55%)
EF-hand_7 80..140 CDD:290234 31/59 (53%)
EF-hand_7 116..185 CDD:290234 35/69 (51%)
EFh 116..182 CDD:298682 33/66 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834887
Domainoid 1 1.000 83 1.000 Domainoid score I8340
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16959
Inparanoid 1 1.050 207 1.000 Inparanoid score I3696
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56894
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005596
OrthoInspector 1 1.000 - - otm42563
orthoMCL 1 0.900 - - OOG6_103375
Panther 1 1.100 - - LDO PTHR34524
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5421
SonicParanoid 1 1.000 - - X4009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.