DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and STK33

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001275990.1 Gene:STK33 / 65975 HGNCID:14568 Length:514 Species:Homo sapiens


Alignment Length:193 Identity:40/193 - (20%)
Similarity:75/193 - (38%) Gaps:52/193 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLKNPNCDLYTLEANMASQALRELTDGEDKDPI----TKLR---LLCLSRGATGILGLGRAFRAM 69
            |.|.|:|       :.|||          ||.:    :|.|   :|.:....|..:|...:..::
Human    10 STKCPDC-------SSASQ----------KDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISL 57

  Fly    70 DDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLN-- 132
            :....|.:|.:  ||..:|.....|..|.|   |:..:.|.|  |.||      ..:|..|:.  
Human    58 ERKKEKNINRD--ITSRKDLPSRTSNVERK---ASQQQWGRG--NFTE------GKVPHIRIENG 109

  Fly   133 -IIDQAF---NKMDRDEDGVI---TIQDLKNVYSVKEHPKYQSGEKS------EDEILTDFLH 182
             .|::.:   ..:.:...|::   |.::.:..:::|:..|.::|..:      |..||....|
Human   110 AAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/56 (25%)
EFh 64..119 CDD:238008 14/54 (26%)
EFh 97..154 CDD:238008 13/65 (20%)
EF-hand_7 98..158 CDD:290234 12/68 (18%)
EF-hand_7 134..204 CDD:290234 10/61 (16%)
STK33NP_001275990.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..91 8/30 (27%)
STKc_STK33 114..381 CDD:270999 9/59 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..468
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..514
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.