DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and EFCAB6

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_011528618.1 Gene:EFCAB6 / 64800 HGNCID:24204 Length:1613 Species:Homo sapiens


Alignment Length:196 Identity:39/196 - (19%)
Similarity:72/196 - (36%) Gaps:59/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKL---- 122
            |.:.|...|::|:..|...:....:....:.::..|.::::|.:|.:|.|.|...|||.||    
Human   878 LSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINY 942

  Fly   123 --------------------RPPMPQSRLNIIDQAFNK--------MDRDEDGVITIQDLKNVYS 159
                                :|...|..:..:.|:..|        |||.       ||:...::
Human   943 SPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRH-------QDISKAFT 1000

  Fly   160 VKEHPK--YQSGEKSEDEILTDFLHNFEGGRGNLDGKIT----------REEFVNYYATISASID 212
            ..:..|  |.|..|.: |:|.      |.|....:|::|          .:..:||...:.| ::
Human  1001 KTDQSKTNYISICKMQ-EVLE------ECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRA-VE 1057

  Fly   213 N 213
            |
Human  1058 N 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 12/56 (21%)
EFh 64..119 CDD:238008 11/54 (20%)
EFh 97..154 CDD:238008 19/88 (22%)
EF-hand_7 98..158 CDD:290234 19/91 (21%)
EF-hand_7 134..204 CDD:290234 18/89 (20%)
EFCAB6XP_011528618.1 EFh 100..152 CDD:298682
EF-hand_7 203..261 CDD:290234
EFh 203..261 CDD:298682
FRQ1 320..495 CDD:227455
EFh 434..494 CDD:238008
FRQ1 989..1135 CDD:227455 19/85 (22%)
EF-hand_11 1186..1286 CDD:286115
EFh 1211..1264 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.