DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Dapk3

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006241053.1 Gene:Dapk3 / 64391 RGDID:621766 Length:464 Species:Rattus norvegicus


Alignment Length:190 Identity:45/190 - (23%)
Similarity:70/190 - (36%) Gaps:68/190 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIR 87
            |||:|.|              |..:..:.|| ||:..||               ..::|.:|.|.
  Rat   212 LEADMWS--------------IGVITYILLS-GASPFLG---------------ETKQETLTNIS 246

  Fly    88 DTGLDVSEEEIKQMFATFDED--GSGSINMTEFLLKLRPPMPQSRLNI---IDQAFNKMDRDEDG 147
            ....|            |||:  .|.|....:|:.:|....|:.|:.|   ::.::.|:.|.|||
  Rat   247 AVNYD------------FDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKVRRREDG 299

  Fly   148 V-------ITIQDLKNVYSVKEH---PK---YQSGEKSEDEILTDF------LHNFEGGR 188
            .       :....|:. ||:|.|   |:   |.|.|:. ..:|.|.      |...:.||
  Rat   300 ARKPERRRLRAARLRE-YSLKSHSSMPRNTSYASFERF-SRVLEDVAAAEQGLRELQRGR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 9/58 (16%)
EFh 64..119 CDD:238008 9/56 (16%)
EFh 97..154 CDD:238008 15/68 (22%)
EF-hand_7 98..158 CDD:290234 16/71 (23%)
EF-hand_7 134..204 CDD:290234 19/74 (26%)
Dapk3XP_006241053.1 STKc_DAPK 23..291 CDD:271007 26/120 (22%)
S_TKc 29..291 CDD:214567 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.