DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and dclk2a

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001128593.1 Gene:dclk2a / 572548 ZFINID:ZDB-GENE-050420-170 Length:810 Species:Danio rerio


Alignment Length:181 Identity:31/181 - (17%)
Similarity:80/181 - (44%) Gaps:28/181 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLCLSRGATGILGLGRAFRAM--DDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSG 111
            |:.|:|..:..:.|.:..|::  .|.|.|..:.::.:.|  ::.:..|.|..:::..|.:.:.:.
Zfish    95 LMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEG--ESYVCASNEPFRKVDYTKNVNPNW 157

  Fly   112 SINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEK---SE 173
            |:|:.....:..|.:..::..:.::  ...|..:..::|:  :::....::..:....:|   |.
Zfish   158 SVNVKTGASRSMPSLTATKNELRER--ESKDYIKPKLVTV--IRSGVKPRKAVRILLNKKTAHSF 218

  Fly   174 DEILTDFLHNFEGGRG------NLDGK--ITREEFVNYYATISASIDNDMF 216
            :::|||.....:...|      .|:||  |..::|..         |:|:|
Zfish   219 EQVLTDITDAIKLDSGAVKRLYTLEGKQIICLQDFFG---------DDDVF 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/58 (19%)
EFh 64..119 CDD:238008 10/56 (18%)
EFh 97..154 CDD:238008 6/56 (11%)
EF-hand_7 98..158 CDD:290234 6/59 (10%)
EF-hand_7 134..204 CDD:290234 13/80 (16%)
dclk2aNP_001128593.1 DCX 59..149 CDD:214711 11/55 (20%)
DCX 186..274 CDD:214711 16/86 (19%)
STKc_DCKL2 418..676 CDD:271086
S_TKc 420..677 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.