Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_705718.1 | Gene: | CAMK1D / 57118 | HGNCID: | 19341 | Length: | 385 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 32/200 - (16%) |
---|---|---|---|
Similarity: | 70/200 - (35%) | Gaps: | 72/200 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNE----- 79
Fly 80 ---EEFITGIRD---------------TGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPM 126
Fly 127 PQSRLNIIDQAF--NKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRG 189
Fly 190 NLDGK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 13/79 (16%) |
EFh | 64..119 | CDD:238008 | 13/77 (17%) | ||
EFh | 97..154 | CDD:238008 | 8/58 (14%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 11/61 (18%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 13/62 (21%) | ||
CAMK1D | NP_705718.1 | STKc_CaMKI_delta | 12..312 | CDD:271070 | 31/199 (16%) |
Autoinhibitory domain. /evidence=ECO:0000250 | 279..319 | ||||
Calmodulin-binding. /evidence=ECO:0000250 | 299..320 | ||||
Nuclear export signal. /evidence=ECO:0000250 | 318..324 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 360..385 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |