| Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021334681.1 | Gene: | spegb / 563174 | ZFINID: | ZDB-GENE-081104-517 | Length: | 3608 | Species: | Danio rerio |
| Alignment Length: | 218 | Identity: | 43/218 - (19%) |
|---|---|---|---|
| Similarity: | 64/218 - (29%) | Gaps: | 93/218 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 PITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALN--------EEEFITGI------------- 86
Fly 87 -------------------RDTGLDVSEEEIKQMFA----------------------TFDEDGS 110
Fly 111 G-SINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSED 174
Fly 175 EILTDFLHNFEGGRGNLDGKITR 197 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 16/119 (13%) |
| EFh | 64..119 | CDD:238008 | 16/117 (14%) | ||
| EFh | 97..154 | CDD:238008 | 15/79 (19%) | ||
| EF-hand_7 | 98..158 | CDD:290234 | 16/82 (20%) | ||
| EF-hand_7 | 134..204 | CDD:290234 | 14/64 (22%) | ||
| spegb | XP_021334681.1 | I-set | 55..137 | CDD:254352 | |
| DUF4045 | <228..687 | CDD:330572 | |||
| I-set | 781..870 | CDD:254352 | |||
| I-set | 928..1018 | CDD:254352 | |||
| I-set | 1029..1117 | CDD:254352 | |||
| I-set | 1123..1212 | CDD:254352 | |||
| I-set | 1249..1338 | CDD:254352 | |||
| FN3 | 1343..1436 | CDD:238020 | |||
| Ig | <1479..1541 | CDD:325142 | |||
| I-set | 1545..1634 | CDD:254352 | |||
| PKc_like | 1659..1913 | CDD:328722 | 16/80 (20%) | ||
| I-set | 2861..2949 | CDD:254352 | |||
| FN3 | 2955..3044 | CDD:238020 | |||
| PKc_like | 3296..3552 | CDD:328722 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||