DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and dclk1a

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	XP_005172728.1	Gene:	dclk1a / 558997	ZFINID:	ZDB-GENE-061013-124	Length:	770	Species:	Danio rerio

Alignment Length:	164	Identity:	34/164 - (20%)
Similarity:	57/164 - (34%)	Gaps:	55/164 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 LKNPNCDLYTLEANMASQ--ALRELTDGEDK-DPITKLRLLCLSRGATGIL-GLGRAFRAMDDDG 73
            :|:||..|...|.:..::  .:.||..|.|. |.||..... ..|.|:|:| .|..|.:.:.
Zfish   436 VKHPNIVLLIEEMDTYNELYLVMELVKGGDLFDAITSANRY-TERDASGMLYNLASAIKYLH--- 496

  Fly    74 SKALNEEEFITGIRDTGLDVSEEEIK--QMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQ 136
                            .|::...:||  .:.....:|||.|:.:.:|
Zfish   497 ----------------SLNIVHRDIKPENLLVYEHQDGSKSLKLGDF------------------ 527

  Fly   137 AFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGE 170
                      |:.|:.| ..:|:|...|.|.:.|
Zfish   528 ----------GLATVVD-GPLYTVCGTPTYVAPE 550

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	9/58 (16%)
		EFh	64..119	CDD:238008	8/56 (14%)
		EFh	97..154	CDD:238008	9/58 (16%)
		EF-hand_7	98..158	CDD:290234	10/61 (16%)
		EF-hand_7	134..204	CDD:290234	8/37 (22%)
dclk1a	XP_005172728.1	DCX	46..137	CDD:214711
		DCX	174..262	CDD:214711
		STKc_DCKL1	376..643	CDD:271085	34/164 (21%)
		S_TKc	383..640	CDD:214567	34/164 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900