DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and dapk1

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_001093460.1	Gene:	dapk1 / 558314	ZFINID:	ZDB-GENE-060526-177	Length:	1439	Species:	Danio rerio

Alignment Length:	88	Identity:	22/88 - (25%)
Similarity:	33/88 - (37%)	Gaps:	24/88 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 LRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSG 111
            :|.||||         |....|:.:||..|          .|......:|.:..:.|...:|...
Zfish   626 VRHLCLS---------GANTEAITNDGKTA----------EDLATAEQQEHVAVLLAKLKKDNHK 671

  Fly   112 SINMTEFLLKLRPPMP-QSRLNI 133
            ||    ::.:|||... |.||.:
Zfish   672 SI----YIQQLRPTQTLQHRLKL 690

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	11/56 (20%)
		EFh	64..119	CDD:238008	10/54 (19%)
		EFh	97..154	CDD:238008	10/38 (26%)
		EF-hand_7	98..158	CDD:290234	10/37 (27%)
		EF-hand_7	134..204	CDD:290234	22/88 (25%)
dapk1	NP_001093460.1	STKc_DAPK1	7..275	CDD:271096
		S_TKc	13..275	CDD:214567
		Ank_2	<337..409	CDD:289560
		ANK	373..497	CDD:238125
		ANK repeat	378..409	CDD:293786
		Ank_4	379..432	CDD:290365
		ANK repeat	412..442	CDD:293786
		Ank_2	416..508	CDD:289560
		ANK	439..564	CDD:238125
		ANK repeat	444..475	CDD:293786
		ANK repeat	477..508	CDD:293786
		ANK	505..629	CDD:238125	1/2 (50%)
		ANK repeat	510..541	CDD:293786
		Ank_4	513..564	CDD:290365
		ANK repeat	543..574	CDD:293786
		Ank_2	548..635	CDD:289560	6/17 (35%)
		ANK repeat	576..607	CDD:293786
		ANK	604..>671	CDD:238125	14/63 (22%)
		ANK repeat	609..638	CDD:293786	6/20 (30%)
		Ank_4	610..662	CDD:290365	12/54 (22%)
		Death_DAPK1	1310..1399	CDD:260052
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900