DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and capsla

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001017676.1 Gene:capsla / 550371 ZFINID:ZDB-GENE-030131-7291 Length:188 Species:Danio rerio


Alignment Length:199 Identity:101/199 - (50%)
Similarity:140/199 - (70%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGL 91
            ||:.||::            ||..||||||.||.||||.||:|||||||:|:.:||:.|::|.|:
Zfish     1 MAADALQD------------LRQQCLSRGAAGIKGLGRMFRSMDDDGSKSLDFQEFVRGLQDYGV 53

  Fly    92 DVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKN 156
            .|..::.:|:||..|:|||||||..|||.||||||..:|:.:|.|||.|.|:..|||.|::||:.
Zfish    54 SVGRDQAQQIFAMMDKDGSGSINFDEFLEKLRPPMSSARMQVIRQAFQKFDKSGDGVETVEDLQG 118

  Fly   157 VYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFDLMM 221
            ||:.|.||||:|||.:|.::...||.:|:... :.|||:|.|||||||:.:|||:|:|.:|..||
Zfish   119 VYNSKHHPKYKSGEWTETQVFHSFLDSFDSPH-DKDGKVTLEEFVNYYSGVSASVDSDEYFISMM 182

  Fly   222 RRAY 225
            :.|:
Zfish   183 KSAW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 31/56 (55%)
EFh 64..119 CDD:238008 29/54 (54%)
EFh 97..154 CDD:238008 31/56 (55%)
EF-hand_7 98..158 CDD:290234 33/59 (56%)
EF-hand_7 134..204 CDD:290234 35/69 (51%)
capslaNP_001017676.1 EF-hand_7 24..82 CDD:290234 32/57 (56%)
EFh 26..82 CDD:238008 30/55 (55%)
EFh 59..>109 CDD:238008 27/49 (55%)
EF-hand_7 60..120 CDD:290234 33/59 (56%)
EF-hand_7 96..165 CDD:290234 35/69 (51%)
EFh 96..162 CDD:298682 32/66 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577968
Domainoid 1 1.000 80 1.000 Domainoid score I8536
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3592
OMA 1 1.010 - - QHG56894
OrthoDB 1 1.010 - - D1377102at2759
OrthoFinder 1 1.000 - - FOG0005596
OrthoInspector 1 1.000 - - mtm6408
orthoMCL 1 0.900 - - OOG6_103375
Panther 1 1.100 - - O PTHR34524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.