DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and capsl

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_012817881.1 Gene:capsl / 549278 XenbaseID:XB-GENE-962396 Length:208 Species:Xenopus tropicalis


Alignment Length:202 Identity:103/202 - (50%)
Similarity:147/202 - (72%) Gaps:3/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRD 88
            :.:||.||.:.|:  ...||:.||||.|||||:.||.||||.||.|||||:|.|:.:||..|:.|
 Frog     8 DRDMALQAKKNLS--SCTDPVEKLRLQCLSRGSAGIKGLGRVFRIMDDDGNKTLDFKEFSKGLSD 70

  Fly    89 TGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQD 153
            .|:.:.:.|.:::|:.||:||||:|:..|||:.|||||..:|.::|.|||.|:|:..|||:||:|
 Frog    71 YGVMMDKTETQELFSVFDKDGSGTIDFDEFLVTLRPPMSNARKDMILQAFRKLDKSGDGVVTIED 135

  Fly   154 LKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFD 218
            |:.||:.|.|||||:||.:||::...||.||:... :.||::|.:||:||||.:|||||.|::|.
 Frog   136 LRGVYNAKHHPKYQNGEWTEDQVFRSFLDNFDSPY-DKDGQVTPDEFMNYYAGVSASIDTDIYFI 199

  Fly   219 LMMRRAY 225
            .|||.|:
 Frog   200 TMMRNAW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 27/56 (48%)
EFh 64..119 CDD:238008 25/54 (46%)
EFh 97..154 CDD:238008 29/56 (52%)
EF-hand_7 98..158 CDD:290234 30/59 (51%)
EF-hand_7 134..204 CDD:290234 35/69 (51%)
capslXP_012817881.1 EF-hand_7 44..101 CDD:290234 27/56 (48%)
EFh 46..101 CDD:238008 25/54 (46%)
EFh 79..136 CDD:238008 29/56 (52%)
EF-hand_7 81..140 CDD:290234 30/58 (52%)
EFh 115..182 CDD:298682 33/67 (49%)
EF-hand_7 116..185 CDD:290234 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9988
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H16959
Inparanoid 1 1.050 213 1.000 Inparanoid score I3536
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377102at2759
OrthoFinder 1 1.000 - - FOG0005596
OrthoInspector 1 1.000 - - mtm9381
Panther 1 1.100 - - LDO PTHR34524
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5421
SonicParanoid 1 1.000 - - X4009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.