powered by:
Protein Alignment CG10126 and rheb
DIOPT Version :9
Sequence 1: | NP_788664.2 |
Gene: | CG10126 / 41579 |
FlyBaseID: | FBgn0038088 |
Length: | 227 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001015922.1 |
Gene: | rheb / 548676 |
XenbaseID: | XB-GENE-492096 |
Length: | 184 |
Species: | Xenopus tropicalis |
Alignment Length: | 48 |
Identity: | 13/48 - (27%) |
Similarity: | 24/48 - (50%) |
Gaps: | 3/48 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 SINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYS 159
|:|..|:.|:|.....|...:||.|.:: .|.:|.|.:..:.::.|
Frog 48 SVNGQEYQLQLVDTAGQDEFSIIPQTYS---IDINGYILVYSVTSIKS 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.