DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and rheb

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_001015922.1	Gene:	rheb / 548676	XenbaseID:	XB-GENE-492096	Length:	184	Species:	Xenopus tropicalis

Alignment Length:	48	Identity:	13/48 - (27%)
Similarity:	24/48 - (50%)	Gaps:	3/48 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   112 SINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYS 159
            |:|..|:.|:|.....|...:||.|.::   .|.:|.|.:..:.::.|
Frog    48 SVNGQEYQLQLVDTAGQDEFSIIPQTYS---IDINGYILVYSVTSIKS 92

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	3/6 (50%)
		EFh	64..119	CDD:238008	3/6 (50%)
		EFh	97..154	CDD:238008	12/41 (29%)
		EF-hand_7	98..158	CDD:290234	12/45 (27%)
		EF-hand_7	134..204	CDD:290234	6/26 (23%)
rheb	NP_001015922.1	RheB	6..184	CDD:206709	13/48 (27%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900