Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524622.1 | Gene: | CaMKI / 43792 | FlyBaseID: | FBgn0016126 | Length: | 405 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 41/197 - (20%) |
---|---|---|---|
Similarity: | 70/197 - (35%) | Gaps: | 41/197 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RTKGWSLKNPNCDL-----YTLEANMASQALRELTDGEDKDP---------ITKLRLLCLSRGAT 57
Fly 58 GILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMT------ 116
Fly 117 --EFLLKLRPPMPQSRLNIIDQAFNKMD-RDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILT 178
Fly 179 DF 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 13/64 (20%) |
EFh | 64..119 | CDD:238008 | 13/62 (21%) | ||
EFh | 97..154 | CDD:238008 | 10/65 (15%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 13/68 (19%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 14/48 (29%) | ||
CaMKI | NP_524622.1 | STKc_CaMKI | 27..301 | CDD:270985 | 37/182 (20%) |
S_TKc | 31..302 | CDD:214567 | 37/178 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |