DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CaMKI

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:197 Identity:41/197 - (20%)
Similarity:70/197 - (35%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTKGWSLKNPNCDL-----YTLEANMASQALRELTDGEDKDP---------ITKLRLLCLSRGAT 57
            :.|...||..|..:     |.|...:.:.|..|:...|.||.         |.|..|........
  Fly    12 KAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLE 76

  Fly    58 GILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMT------ 116
            ..:.:.|.|.|...|| |.||           |..::...|.|:..|:::.....:.|.      
  Fly    77 NEIRVLRRFSANHFDG-KCLN-----------GTRLTHPNIVQLLETYEDKSKVYLVMELVTGGE 129

  Fly   117 --EFLLKLRPPMPQSRLNIIDQAFNKMD-RDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILT 178
              :.:::......:...::|.|....:| ..|.||:. :|||     .|:..|.|.:.....:::
  Fly   130 LFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVH-RDLK-----PENLLYYSPDDDSKIMIS 188

  Fly   179 DF 180
            ||
  Fly   189 DF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/64 (20%)
EFh 64..119 CDD:238008 13/62 (21%)
EFh 97..154 CDD:238008 10/65 (15%)
EF-hand_7 98..158 CDD:290234 13/68 (19%)
EF-hand_7 134..204 CDD:290234 14/48 (29%)
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 37/182 (20%)
S_TKc 31..302 CDD:214567 37/178 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.