DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and TpnC73F

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster


Alignment Length:170 Identity:36/170 - (21%)
Similarity:63/170 - (37%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTE-------FL 119
            |.:||.:.|...:.::..|.....:|..|....::.::::....|||.||.:...|       |:
  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKFI 80

  Fly   120 LKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNF 184
            ::......|..|.   :||...|:..:|.|....||                   |||.:     
  Fly    81 VEEDAEAMQKELR---EAFRLYDKQGNGFIPTTCLK-------------------EILKE----- 118

  Fly   185 EGGRGNLDGKITREEFVNYYATI----SASIDNDMFFDLM 220
                  ||.::|.:|.......|    |.::|.|.|.::|
  Fly   119 ------LDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/63 (21%)
EFh 64..119 CDD:238008 12/61 (20%)
EFh 97..154 CDD:238008 14/63 (22%)
EF-hand_7 98..158 CDD:290234 16/66 (24%)
EF-hand_7 134..204 CDD:290234 14/69 (20%)
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 36/170 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.