DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and camk1gb

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	XP_021325441.1	Gene:	camk1gb / 393802	ZFINID:	ZDB-GENE-040426-1694	Length:	486	Species:	Danio rerio

Alignment Length:	148	Identity:	32/148 - (21%)
Similarity:	57/148 - (38%)	Gaps:	46/148 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    94 SEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRD-EDGVITIQDLK-- 155
            |.:.|:.:|...|..|||:.:.. |::|.|.......:..:.:. ||.|.: |:.:..::.:|
Zfish    66 STDNIQDVFDFMDVLGSGAFSEV-FMVKERKTGKLFAMKCVKKK-NKRDINLENEIAVLRKIKHE 128

  Fly   156 NV------YSVKEH----PKYQSGEKSEDEIL--------------------TDFLHNFEGGRGN 190
            ||      |..:.|    .:..||.:..|.||                    ..:|||
Zfish   129 NVVCLEDFYESRTHYYLVMQLVSGGELFDRILDRGMYSEMDASSVIRQVLEAVSYLHN------- 186

  Fly   191 LDGKITRE---EFVNYYA 205
             :|.:.|:   |.:.||:
Zfish   187 -NGIVHRDLKPENLLYYS 203

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	7/24 (29%)
		EFh	64..119	CDD:238008	7/24 (29%)
		EFh	97..154	CDD:238008	13/57 (23%)
		EF-hand_7	98..158	CDD:290234	16/68 (24%)
		EF-hand_7	134..204	CDD:290234	20/105 (19%)
camk1gb	XP_021325441.1	PKc_like	70..353	CDD:328722	31/144 (22%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900