DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and stk17b

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_956829.1	Gene:	stk17b / 393507	ZFINID:	ZDB-GENE-040426-1499	Length:	354	Species:	Danio rerio

Alignment Length:	137	Identity:	35/137 - (25%)
Similarity:	50/137 - (36%)	Gaps:	32/137 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 DPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEF-ITGIRDTGLDVSE---EEIKQMF 102
            :|||....|......|.:|..|.:..|.||.....||..:. :...|:|...|||   :.|:::.
Zfish   207 EPITTATDLWSVGVITYMLVTGESPFAGDDKQETFLNVSQVNVEYSRETFSRVSELAVDFIRKLL 271

  Fly   103 ATFDED------------------GSGSINMTEFLLKLR---------PPMPQSRLNIIDQAFNK 140
            ....||                  ||..:.||....:.|         |..|:.:.||:|....|
Zfish   272 VKAPEDRPSAADCMTHPWLWLQYPGSDPVPMTPRTPRERSFGGKWSAPPEDPEDKENILDSPHAK 336

  Fly   141 MDR-DED 146
            ..| |||
Zfish   337 RFRFDED 343

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	18/78 (23%)
		EFh	64..119	CDD:238008	17/76 (22%)
		EFh	97..154	CDD:238008	18/78 (23%)
		EF-hand_7	98..158	CDD:290234	18/77 (23%)
		EF-hand_7	134..204	CDD:290234	6/14 (43%)
stk17b	NP_956829.1	STKc_DRAK2	24..290	CDD:271100	20/82 (24%)
stk17b	NP_956829.1	S_TKc	32..290	CDD:214567	20/82 (24%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900