DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and Obscn

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_001164983.2	Gene:	Obscn / 380698	MGIID:	2681862	Length:	8032	Species:	Mus musculus

Alignment Length:	269	Identity:	58/269 - (21%)
Similarity:	94/269 - (34%)	Gaps:	70/269 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MFLREIRTKGWSLKNPNCDLYTLEANMASQA-----LRELTDGEDKDPITKLRLLC-LSRGATGI 59
            :.||::|.:.....:..|...|..|.:...|     |||| ..:|.|.....||.| |||.|..:
Mouse  4263 LLLRDLRREDAGEYSCTCGSQTTSATLMVTAAPVRFLREL-QAQDVDEGATARLRCELSREAVSV 4326

  Fly    60 ---LGLGRAFRA----MDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTE 117
               .|..:.|..    |..:|:.|   |..:.|:...  |..|       .|.|...:.||..
Mouse  4327 EWRKGSLQLFPCAKYQMVQEGTTA---ELLVHGVEQE--DAGE-------YTCDAGHTQSIAR-- 4377

  Fly   118 FLLKLRPPMPQSR--LNIIDQAFN-------KMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSE 173
              |.:|.|.|:.:  |...:|...       ::...|.|. .:|.||....:....||:.  :.:
Mouse  4378 --LSVRAPKPKFKTDLQSTEQEAGGTARLCCQLSEAEPGT-PVQWLKEGVELHVGSKYEM--RRQ 4437

  Fly   174 DEILTDFLHNFE-----------GG-----------------RGNLDGKITREEFVNYYATISAS 210
            ..:....:|..|           ||                 ||.:|.::..:|.|.:...:|.:
Mouse  4438 GAVCELLIHGLEAKDTGEYACLVGGQKTLASLRVKEPEVTIVRGLVDMEVQADEDVEFTCKVSQA 4502

  Fly   211 IDNDMFFDL 219
            ...|:.:.|
Mouse  4503 GATDVQWHL 4511

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	12/60 (20%)
		EFh	64..119	CDD:238008	12/58 (21%)
		EFh	97..154	CDD:238008	13/65 (20%)
		EF-hand_7	98..158	CDD:290234	15/68 (22%)
		EF-hand_7	134..204	CDD:290234	17/104 (16%)
Obscn	NP_001164983.2	I-set	3855..3938	CDD:254352
		IGc2	3868..3926	CDD:197706
		I-set	3943..4026	CDD:254352
		Ig_2	3951..4021	CDD:290606
		I-set	4031..4114	CDD:254352
		IGc2	4044..4102	CDD:197706
		I-set	4119..4202	CDD:254352
		I-set	4208..4291	CDD:254352	6/27 (22%)
		ig	4211..4279	CDD:278476	3/15 (20%)
		I-set	4297..4380	CDD:254352	27/99 (27%)
		Ig	4313..4381	CDD:143165	21/83 (25%)
		I-set	4385..4471	CDD:254352	14/88 (16%)
		Ig	4399..4464	CDD:299845	11/67 (16%)
		I-set	4478..4563	CDD:254352	8/34 (24%)
		Ig	4490..4547	CDD:299845	5/22 (23%)
		I-set	4566..4654	CDD:254352
		I-set	4660..4745	CDD:254352
		FN3	4749..4834	CDD:238020
		I-set	4862..4923	CDD:254352
		I-set	5127..5217	CDD:254352
		Ig	5144..5213	CDD:143165
		I-set	5357..5447	CDD:254352
		Ig	5375..5444	CDD:143165
		I-set	5489..5579	CDD:254352
		Ig	5513..5579	CDD:299845
		Ig	5599..5695	CDD:299845
		I-set	5600..5695	CDD:254352
		SH3_Obscurin_like	5831..5893	CDD:212958
		RhoGEF	5926..6102	CDD:295373
		PH_Obscurin	6111..6235	CDD:270059
		I-set	6243..6335	CDD:254352
		Ig	8..90	CDD:299845
		I-set	9..98	CDD:254352
		I-set	109..200	CDD:254352
		Ig	126..190	CDD:143165
		IG	246..326	CDD:214652
		Ig	250..319	CDD:299845
		I-set	333..416	CDD:254352
		I-set	423..499	CDD:254352
		FN3	513..600	CDD:238020
		I-set	615..>671	CDD:254352
		IGc2	<732..781	CDD:197706
		IGc2	878..941	CDD:197706
		IGc2	970..1033	CDD:197706
		IGc2	1062..1125	CDD:197706
		IGc2	1154..1217	CDD:197706
		IGc2	1246..1309	CDD:197706
		IGc2	1338..1401	CDD:197706
		IGc2	1430..1493	CDD:197706
		IGc2	1522..1585	CDD:197706
		IGc2	1614..1677	CDD:197706
		IGc2	1706..1769	CDD:197706
		IGc2	1798..1861	CDD:197706
		IGc2	1891..1950	CDD:197706
		I-set	1967..2050	CDD:254352
		Ig	1983..2051	CDD:143165
		I-set	2057..2140	CDD:254352
		IGc2	2069..2132	CDD:197706
		I-set	2147..2229	CDD:254352
		I-set	2324..2406	CDD:254352
		Ig	2331..2395	CDD:299845
		I-set	2449..2530	CDD:254352
		Ig	2464..2531	CDD:143165
		I-set	2626..2709	CDD:254352
Ig	2642..2710	CDD:143165
I-set	2716..2798	CDD:254352
I-set	2804..2887	CDD:254352
Ig	2820..2888	CDD:143165
I-set	2894..>2962	CDD:254352
I-set	2985..3065	CDD:254352
Ig_2	2989..3060	CDD:290606
I-set	3073..3156	CDD:254352
IG	3168..3247	CDD:214652
I-set	3254..3336	CDD:254352
Ig_2	3258..3337	CDD:290606
I-set	3342..3425	CDD:254352
ig	3346..3412	CDD:278476
I-set	3431..3513	CDD:254352
IGc2	3443..3501	CDD:197706
I-set	3519..3601	CDD:254352
IGc2	3531..3589	CDD:197706
I-set	3612..3689	CDD:254352
IGc2	3619..3677	CDD:197706
I-set	3695..>3763	CDD:254352
I-set	3768..3850	CDD:254352
IGc2	3780..3838	CDD:197706
Ig	6260..6327	CDD:143165
IG_like	6349..6427	CDD:214653
IGc2	6350..6418	CDD:197706
I-set	6452..6541	CDD:254352
Ig	6475..6538	CDD:143165
PKc_like	6559..6815	CDD:304357
S_TKc	6562..6815	CDD:214567
IGc2	7540..7606	CDD:197706
FN3	7620..7698	CDD:214495
PKc_like	7732..7988	CDD:304357
S_TKc	7741..7984	CDD:214567
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900