DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Speg

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_038939815.1 Gene:Speg / 363256 RGDID:2124 Length:3269 Species:Rattus norvegicus


Alignment Length:174 Identity:36/174 - (20%)
Similarity:67/174 - (38%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMT 116
            ||..:..:..|||:.|.: ..||:.|::.:|.            ||.::.....|...:      
  Rat   391 LSEASGRLSALGRSPRLV-RAGSRILDKLQFF------------EERRRSLERSDSPPA------ 436

  Fly   117 EFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGV------ITIQDLKNVY-SVKEHPK-YQSGEKSE 173
                .|||.:|..:...::|     .:.|.|.      .:.::|::.. ||.|..: :|....|.
  Rat   437 ----PLRPWVPLRKARSLEQ-----PKSEGGAAWDTPGASQEELRSPRGSVAERRRLFQQKAASL 492

  Fly   174 DE------ILTDFLHNFEGGRGNLDGKITREEFVNYYATISASI 211
            ||      ..:|....|....|.:....:|||.|..:.::.|::
  Rat   493 DERTRQRSATSDLELRFAQELGRIRRSTSREELVRSHESLRATL 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/56 (20%)
EFh 64..119 CDD:238008 9/54 (17%)
EFh 97..154 CDD:238008 9/62 (15%)
EF-hand_7 98..158 CDD:290234 9/65 (14%)
EF-hand_7 134..204 CDD:290234 18/83 (22%)
SpegXP_038939815.1 I-set 45..127 CDD:400151
Ig strand A 45..47 CDD:409353
Ig strand A' 49..55 CDD:409353
Ig strand B 62..69 CDD:409353
Ig strand C 75..80 CDD:409353
Ig strand C' 82..85 CDD:409353
Ig strand F 106..114 CDD:409353
Ig strand G 117..127 CDD:409353
PHA03247 <324..681 CDD:223021 36/174 (21%)
Ig strand A 736..739 CDD:409353
I-set 737..826 CDD:400151
Ig strand A' 742..746 CDD:409353
Ig strand B 754..762 CDD:409353
Ig strand C 767..772 CDD:409353
Ig strand C' 775..777 CDD:409353
Ig strand D 783..788 CDD:409353
Ig strand E 791..796 CDD:409353
Ig strand F 805..813 CDD:409353
Ig strand G 816..826 CDD:409353
SPEG_u2 827..883 CDD:293256
IgI_APEG-1_like 884..974 CDD:409567
Ig strand B 901..905 CDD:409567
Ig strand C 914..918 CDD:409567
Ig strand E 940..944 CDD:409567
Ig strand F 954..959 CDD:409567
Ig strand G 967..970 CDD:409567
Ig 988..1073 CDD:416386
Ig strand A' 991..994 CDD:409353
Ig strand B 998..1007 CDD:409353
Ig strand C 1012..1018 CDD:409353
Ig strand C' 1021..1023 CDD:409353
Ig strand D 1030..1035 CDD:409353
Ig strand E 1038..1045 CDD:409353
Ig strand F 1053..1060 CDD:409353
Ig strand G 1063..1073 CDD:409353
Ig 1079..1168 CDD:416386
Ig strand A 1079..1082 CDD:409353
Ig strand A' 1085..1090 CDD:409353
Ig strand B 1095..1102 CDD:409353
Ig strand C 1109..1115 CDD:409353
Ig strand C' 1116..1119 CDD:409353
Ig strand D 1124..1130 CDD:409353
Ig strand E 1133..1143 CDD:409353
Ig strand F 1147..1155 CDD:409353
Ig strand G 1157..1168 CDD:409353
I-set 1203..1292 CDD:400151
Ig strand A 1203..1206 CDD:409353
Ig strand A' 1209..1214 CDD:409353
Ig strand B 1219..1226 CDD:409353
Ig strand C 1233..1239 CDD:409353
Ig strand C' 1240..1243 CDD:409353
Ig strand D 1248..1254 CDD:409353
Ig strand E 1257..1267 CDD:409353
Ig strand F 1271..1279 CDD:409353
Ig strand G 1281..1292 CDD:409353
I-set 1500..1589 CDD:400151
Ig strand A' 1508..1511 CDD:409353
Ig strand B 1515..1524 CDD:409353
Ig strand C 1529..1535 CDD:409353
Ig strand C' 1538..1540 CDD:409353
Ig strand D 1546..1551 CDD:409353
Ig strand E 1554..1561 CDD:409353
Ig strand F 1569..1576 CDD:409353
Ig strand G 1579..1589 CDD:409353
STKc_SPEG_rpt1 1613..1869 CDD:271010
PHA03247 <1951..2352 CDD:223021
I-set 2594..2684 CDD:400151
Ig strand A 2594..2596 CDD:409353
Ig strand A' 2599..2604 CDD:409353
Ig strand B 2611..2619 CDD:409353
Ig strand C 2624..2628 CDD:409353
Ig strand D 2639..2646 CDD:409353
Ig strand E 2649..2654 CDD:409353
Ig strand F 2663..2671 CDD:409353
Ig strand G 2674..2684 CDD:409353
PHA03247 <2785..2910 CDD:223021
PKc_like 2964..3220 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.