DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and sqa

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:227 Identity:47/227 - (20%)
Similarity:79/227 - (34%) Gaps:59/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DPITKLRLL---------------CLSRG----ATGIL------GLGRAFRAMDDDGSKALN--- 78
            ||..:||:|               |:|.|    :.|::      ||.......|.:....:.   
  Fly   183 DPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAK 247

  Fly    79 ---EEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFL----LKLRP-------PM--- 126
               |:|...||....||.    |.::.|   :|.|..:...|.:    |:.||       |:   
  Fly   248 YDFEDECFNGISPECLDF----IAKLLA---KDLSTRMTAAECMKHKWLQQRPATAATATPITKA 305

  Fly   127 ----PQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGG 187
                .:|||..:.......:..||...||:|..:...|......|. ::.:||.|.:...:.|..
  Fly   306 ASAASKSRLKSVSPVTAPSESSEDSTETIEDEDDEEEVAVQQAKQK-DQQQDEELANLCGDAELE 369

  Fly   188 RGNLDGKITREEFVNYYATISASIDNDMFFDL 219
            ...||.  |::...|:........::...||:
  Fly   370 NKELDA--TKDNLKNFIVRWETHPNSPYVFDV 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/62 (21%)
EFh 64..119 CDD:238008 12/60 (20%)
EFh 97..154 CDD:238008 16/74 (22%)
EF-hand_7 98..158 CDD:290234 17/77 (22%)
EF-hand_7 134..204 CDD:290234 15/69 (22%)
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 23/112 (21%)
STKc_MLCK 40..289 CDD:271005 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.