DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and azot

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:141 Identity:43/141 - (30%)
Similarity:67/141 - (47%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEF----LLKLRPPM 126
            ||.:|.|...|:..:|....||..|...::.|::.|....|.:|:|||...||    |.|:|...
  Fly    16 FRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRDTN 80

  Fly   127 PQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNL 191
            .:..|.   :||...|:|.:|.||..:||||::.       .|.|..|:.|.:.:..::..:   
  Fly    81 HEDELR---EAFRIFDKDNNGYITTTELKNVFTA-------LGVKLSDDELEEMIREYDLDQ--- 132

  Fly   192 DGKITREEFVN 202
            |..:..|||||
  Fly   133 DNHLNYEEFVN 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 18/56 (32%)
EFh 64..119 CDD:238008 18/56 (32%)
EFh 97..154 CDD:238008 20/60 (33%)
EF-hand_7 98..158 CDD:290234 22/63 (35%)
EF-hand_7 134..204 CDD:290234 21/69 (30%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 43/141 (30%)
EFh 12..72 CDD:238008 18/55 (33%)
EFh 84..146 CDD:238008 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.