DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and TpnC41C

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:69/177 - (38%) Gaps:40/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMT 116
            |::..|.:  |..||.|.|.:.:..:|.....|.:...|..:.:..:..:.|..||||||.|...
  Fly     5 LTKEQTAL--LRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFE 67

  Fly   117 EFLLK----LRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEIL 177
            ||...    |.....::.:..:.:||...|::.:|.||...|:                   |||
  Fly    68 EFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLR-------------------EIL 113

  Fly   178 TDFLHNFEGGRGNLDGKITREEFVNYYATI----SASIDNDMFFDLM 220
            .:           ||.|:|.::.......|    |.::|.|.|.::|
  Fly   114 RE-----------LDDKLTNDDLDMMIEEIDSDGSGTVDFDEFMEVM 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 17/56 (30%)
EFh 64..119 CDD:238008 16/54 (30%)
EFh 97..154 CDD:238008 17/60 (28%)
EF-hand_7 98..158 CDD:290234 18/63 (29%)
EF-hand_7 134..204 CDD:290234 14/69 (20%)
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 41/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.