DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Caps2

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_011241801.1 Gene:Caps2 / 353025 MGIID:2441980 Length:612 Species:Mus musculus


Alignment Length:221 Identity:58/221 - (26%)
Similarity:109/221 - (49%) Gaps:12/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKNPNCD---LYTLEANMASQALRELTDGEDKDPIT------KLRLLCLSRGATGILGLGRAFRA 68
            |:..|.|   |.:|:|..|.....|....|..|.:.      ||:.....:||..:.||||.|:.
Mouse   388 LRITNIDQVALNSLKAASAEHGEEEAVSPEAHDQLVLQAIQDKLKEQLHKKGARILTGLGRYFQG 452

  Fly    69 MDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDG--SGSINMTEFLLKLRPPMPQSRL 131
            :|.:|:..|.:.:|...::...|:|||::.:..:......|  ...::..||...:...|.:.|.
Mouse   453 LDKEGNGLLEKADFQQALKTFHLEVSEQDFESFWLILQGYGHSKNKVDYGEFKRAIFGEMNEYRK 517

  Fly   132 NIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKIT 196
            :.:.:||.::|.::.|::::.|::..|..|:||:..||..:|:||.:.||...:|.....| :::
Mouse   518 SFVRKAFMQLDFNKTGIVSVIDIRKCYCAKKHPRVISGHSTEEEIKSSFLETLKGTCSKCD-EVS 581

  Fly   197 REEFVNYYATISASIDNDMFFDLMMR 222
            ..||.:||..:|..:..|..|..::|
Mouse   582 YGEFEDYYEGLSIGVAGDEDFVNILR 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/58 (24%)
EFh 64..119 CDD:238008 12/56 (21%)
EFh 97..154 CDD:238008 9/58 (16%)
EF-hand_7 98..158 CDD:290234 10/61 (16%)
EF-hand_7 134..204 CDD:290234 20/69 (29%)
Caps2XP_011241801.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8196
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.