DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and camk1ga

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_956260.1	Gene:	camk1ga / 335654	ZFINID:	ZDB-GENE-030131-7594	Length:	426	Species:	Danio rerio

Alignment Length:	139	Identity:	28/139 - (20%)
Similarity:	52/139 - (37%)	Gaps:	46/139 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    94 SEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVY 158
            |...||::|...:..||||.:.. :|::.|                     :.|        |.|
Zfish    13 STNNIKEIFDFKEVLGSGSFSEV-YLVRER---------------------KSG--------NFY 47

  Fly   159 S---VKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEF----VNYYATISASIDNDMF 216
            :   ||:...:.|..::|.::|....|:      |:.|   .|:|    .:||..:......::|
Zfish    48 ALKCVKKKQLHHSNLENEIQVLKRIKHS------NVVG---LEDFYESRTHYYLVMELVSGGELF 103

  Fly   217 FDLMMRRAY 225
            ..::.|..|
Zfish   104 DRILDRGVY 112

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	8/24 (33%)
		EFh	64..119	CDD:238008	8/24 (33%)
		EFh	97..154	CDD:238008	10/56 (18%)
		EF-hand_7	98..158	CDD:290234	11/59 (19%)
		EF-hand_7	134..204	CDD:290234	13/76 (17%)
camk1ga	NP_956260.1	STKc_CaMKI_gamma	17..300	CDD:271068	27/135 (20%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900