| Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001036462.1 | Gene: | CG17528 / 3355134 | FlyBaseID: | FBgn0261387 | Length: | 748 | Species: | Drosophila melanogaster |
| Alignment Length: | 203 | Identity: | 42/203 - (20%) |
|---|---|---|---|
| Similarity: | 70/203 - (34%) | Gaps: | 63/203 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 REIRTKGWSLKNPNCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRA 68
Fly 69 MDDDGSKALNEEEFITGIRDTGLDVSE--EEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRL 131
Fly 132 NIIDQAFNKMDRDE---DG----------------VITIQDLKNVYSVKEHPKYQSGEKSEDEI- 176
Fly 177 -LTDFLHN 183 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 11/58 (19%) |
| EFh | 64..119 | CDD:238008 | 11/56 (20%) | ||
| EFh | 97..154 | CDD:238008 | 14/75 (19%) | ||
| EF-hand_7 | 98..158 | CDD:290234 | 15/78 (19%) | ||
| EF-hand_7 | 134..204 | CDD:290234 | 18/71 (25%) | ||
| CG17528 | NP_001036462.1 | DCX | 153..244 | CDD:214711 | |
| DCX | 308..396 | CDD:214711 | |||
| PKc_like | 477..734 | CDD:304357 | 25/103 (24%) | ||
| S_TKc | 477..734 | CDD:214567 | 25/103 (24%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||