| Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097440.1 | Gene: | Unc-89 / 3346201 | FlyBaseID: | FBgn0053519 | Length: | 4218 | Species: | Drosophila melanogaster |
| Alignment Length: | 232 | Identity: | 50/232 - (21%) |
|---|---|---|---|
| Similarity: | 94/232 - (40%) | Gaps: | 42/232 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 KGWSLKNPNCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDG 73
Fly 74 SKALNE--EEFITGIRDTGLDVSEEEIKQ-MFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIID 135
Fly 136 QAFNKMDRDEDGVIT-------IQD-LKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLD 192
Fly 193 GKITREEFVNYYATISASI-DNDMFFDLMM---RRAY 225 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 12/59 (20%) |
| EFh | 64..119 | CDD:238008 | 12/57 (21%) | ||
| EFh | 97..154 | CDD:238008 | 14/65 (22%) | ||
| EF-hand_7 | 98..158 | CDD:290234 | 15/68 (22%) | ||
| EF-hand_7 | 134..204 | CDD:290234 | 16/77 (21%) | ||
| Unc-89 | NP_001097440.1 | RhoGEF | 90..260 | CDD:238091 | 37/188 (20%) |
| PH_unc89 | 275..388 | CDD:270134 | |||
| Atrophin-1 | <493..690 | CDD:331285 | |||
| TonB_N | 502..>596 | CDD:318287 | |||
| I-set | 1017..1108 | CDD:333254 | |||
| I-set | 1123..1212 | CDD:254352 | |||
| I-set | <1236..1299 | CDD:333254 | |||
| I-set | 1313..1403 | CDD:254352 | |||
| Ig_3 | 1406..1487 | CDD:316449 | |||
| I-set | 1499..1595 | CDD:254352 | |||
| I-set | 1599..1690 | CDD:333254 | |||
| I-set | 1694..1786 | CDD:254352 | |||
| I-set | <1836..1903 | CDD:333254 | |||
| I-set | 1922..2005 | CDD:333254 | |||
| I-set | 2018..2108 | CDD:333254 | |||
| I-set | 2113..2214 | CDD:333254 | |||
| I-set | 2220..2302 | CDD:254352 | |||
| I-set | 2318..2408 | CDD:254352 | |||
| I-set | 2415..2506 | CDD:254352 | |||
| I-set | 2519..2608 | CDD:254352 | |||
| I-set | 2615..2696 | CDD:254352 | |||
| I-set | 2717..2805 | CDD:254352 | |||
| FN3 | 2834..2925 | CDD:238020 | |||
| I-set | <2996..3063 | CDD:333254 | |||
| I-set | 3067..3157 | CDD:333254 | |||
| PK_Unc-89_rpt1 | 3182..3440 | CDD:271011 | |||
| I-set | 3654..3744 | CDD:333254 | |||
| FN3 | 3748..3840 | CDD:238020 | |||
| STKc_Unc-89_rpt2 | 3893..4151 | CDD:271014 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||