DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Dclk3

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001178729.1 Gene:Dclk3 / 316023 RGDID:1309232 Length:807 Species:Rattus norvegicus


Alignment Length:156 Identity:38/156 - (24%)
Similarity:67/156 - (42%) Gaps:21/156 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITG--IRDTGLDVSEEEI 98
            |.||:|:...:.:        :|.|| ||.....:.......|..|..:|  :|.||:..::.|.
  Rat   458 TRGEEKEAEHEKK--------SGGLG-GRRMLEKESKTKPEENRPERPSGRKLRPTGIISADVEK 513

  Fly    99 KQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIID--QAFNKMDRDEDGVITIQDLKNVYSVK 161
            .........||:.:| :.|  .|.|.......:.|||  |...|.|..:..::.||.|.:...||
  Rat   514 HYDIGRVIGDGNFAI-VKE--CKHRETRQAYAMKIIDKSQLKGKEDIVDSEILIIQSLSHPNIVK 575

  Fly   162 EHPKYQSGEKSEDEILTDFLHNFEGG 187
            .|..|::  ::|..::.:::   :||
  Rat   576 LHEVYET--EAEIYLIMEYV---QGG 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/58 (22%)
EFh 64..119 CDD:238008 12/56 (21%)
EFh 97..154 CDD:238008 15/58 (26%)
EF-hand_7 98..158 CDD:290234 15/61 (25%)
EF-hand_7 134..204 CDD:290234 15/56 (27%)
Dclk3NP_001178729.1 UBQ 92..177 CDD:294102
PKc_like 514..771 CDD:304357 22/91 (24%)
S_TKc 515..772 CDD:214567 22/90 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.