DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Efcab6

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_038936237.1 Gene:Efcab6 / 315179 RGDID:1309065 Length:1509 Species:Rattus norvegicus


Alignment Length:177 Identity:35/177 - (19%)
Similarity:62/177 - (35%) Gaps:55/177 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEF------LLKLRPPMPQ 128
            |.|...::...||:..|....||:|.||.:|:...:|...:|.....:|      |||.:.....
  Rat  1344 DTDKQGSITAAEFLALIEKFKLDISREESQQLLVKYDMKNNGKFAYCDFIQSCVLLLKAKETSLM 1408

  Fly   129 SRLNI---------------------------------IDQAFNKMDRDEDGVITIQDLKNV--- 157
            .|:.|                                 :.:.|...|.:..|::::.|.:.|   
  Rat  1409 RRMRIQNADKMKEAGVETPSFYSALLRIQPKIVHCWRPMRRTFKTYDENGTGLLSVADFRKVLRQ 1473

  Fly   158 YSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYY 204
            :|:         ..||:|    |.|..|....:|..||:..:|:..:
  Rat  1474 FSI---------NLSEEE----FFHVLEYYDKSLSSKISYNDFLRAF 1507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/54 (26%)
EFh 64..119 CDD:238008 14/54 (26%)
EFh 97..154 CDD:238008 13/95 (14%)
EF-hand_7 98..158 CDD:290234 14/101 (14%)
EF-hand_7 134..204 CDD:290234 16/72 (22%)
Efcab6XP_038936237.1 FRQ1 82..264 CDD:227455
EFh_parvalbumin_like <420..490 CDD:330177
EF-hand motif 429..457 CDD:319994
EF-hand motif 465..490 CDD:319994
EFh_PI-PLC 869..980 CDD:333715
EF-hand motif 869..897 CDD:320029
EF-hand_7 873..927 CDD:404394
EF-hand motif 904..929 CDD:320029
FRQ1 1086..1247 CDD:227455
EF-hand_11 1170..1274 CDD:401068
PTZ00183 1335..1505 CDD:185503 35/173 (20%)
EF-hand_7 1447..1507 CDD:404394 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.