DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Camk1d

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001100835.1 Gene:Camk1d / 307124 RGDID:1560691 Length:385 Species:Rattus norvegicus


Alignment Length:200 Identity:32/200 - (16%)
Similarity:70/200 - (35%) Gaps:72/200 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNE----- 79
            ::..:..:.:.|..|:...|:|.......:.|:.:            :|:....|...||     
  Rat    22 IFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPK------------KALKGKESSIENEIAVLR 74

  Fly    80 ---EEFITGIRD---------------TGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPM 126
               .|.|..:.|               :|.::.:..:::.|.| ::|.|..|.            
  Rat    75 KIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYT-EKDASTLIR------------ 126

  Fly   127 PQSRLNIIDQAF--NKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRG 189
                 .::|..:  ::|     |::. :|||     .|:..|.|.::....:::||      |..
  Rat   127 -----QVLDAVYYLHRM-----GIVH-RDLK-----PENLLYYSQDEESKIMISDF------GLS 169

  Fly   190 NLDGK 194
            .::||
  Rat   170 KMEGK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/79 (16%)
EFh 64..119 CDD:238008 13/77 (17%)
EFh 97..154 CDD:238008 8/58 (14%)
EF-hand_7 98..158 CDD:290234 11/61 (18%)
EF-hand_7 134..204 CDD:290234 13/62 (21%)
Camk1dNP_001100835.1 STKc_CaMKI_delta 12..312 CDD:271070 31/199 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.