DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and cmk1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_593464.1 Gene:cmk1 / 2542442 PomBaseID:SPACUNK12.02c Length:335 Species:Schizosaccharomyces pombe


Alignment Length:66 Identity:16/66 - (24%)
Similarity:27/66 - (40%) Gaps:21/66 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 DGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDF--LHNFEGGRGNLDGKITREEFVNYYATIS 208
            |..|..:|||     .|:..|:|.:.:.|.::.||  .|.:|..:              ||..::
pombe   147 DNGIVHRDLK-----PENLLYRSKDPNSDLLIADFGLSHFYEDSQ--------------YYMLMT 192

  Fly   209 A 209
            |
pombe   193 A 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234
EFh 64..119 CDD:238008
EFh 97..154 CDD:238008 2/7 (29%)
EF-hand_7 98..158 CDD:290234 5/11 (45%)
EF-hand_7 134..204 CDD:290234 13/59 (22%)
cmk1NP_593464.1 STKc_CAMK 30..290 CDD:270687 16/66 (24%)
S_TKc 31..291 CDD:214567 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.