powered by:
Protein Alignment CG10126 and cmk1
DIOPT Version :9
Sequence 1: | NP_788664.2 |
Gene: | CG10126 / 41579 |
FlyBaseID: | FBgn0038088 |
Length: | 227 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_593464.1 |
Gene: | cmk1 / 2542442 |
PomBaseID: | SPACUNK12.02c |
Length: | 335 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 27/66 - (40%) |
Gaps: | 21/66 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 DGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDF--LHNFEGGRGNLDGKITREEFVNYYATIS 208
|..|..:||| .|:..|:|.:.:.|.::.|| .|.:|..: ||..::
pombe 147 DNGIVHRDLK-----PENLLYRSKDPNSDLLIADFGLSHFYEDSQ--------------YYMLMT 192
Fly 209 A 209
|
pombe 193 A 193
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.