DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and mek1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_594908.1 Gene:mek1 / 2541604 PomBaseID:SPAC14C4.03 Length:445 Species:Schizosaccharomyces pombe


Alignment Length:151 Identity:36/151 - (23%)
Similarity:55/151 - (36%) Gaps:41/151 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GILGLGRAFRAMDDD---------------GSKALNEEEFITGIRDTGLD-------VSEEEIKQ 100
            ||.|..|.:.|||::               .:|...|:..:|.:|.  ||       ..|...:.
pombe   167 GIGGFSRIYMAMDNNTGGQYACKIIDKKKISTKRFFEDHEMTILRK--LDHPNIIKVNMEYNSET 229

  Fly   101 MFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLK--NVYSVKEH 163
            .|..|:|..:|. ::..:|.||......:.|.|:.|....:....:..|..:|||  |:...   
pombe   230 QFFIFEEMVTGG-DLFSYLTKLGTVPEVTTLFIMFQILQGLKYLHEQNIIHRDLKLENILIA--- 290

  Fly   164 PKYQSGEKSEDE----ILTDF 180
                   .|.|.    |||||
pombe   291 -------SSSDTIFRIILTDF 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/78 (19%)
EFh 64..119 CDD:238008 15/76 (20%)
EFh 97..154 CDD:238008 11/56 (20%)
EF-hand_7 98..158 CDD:290234 15/61 (25%)
EF-hand_7 134..204 CDD:290234 13/53 (25%)
mek1NP_594908.1 FHA 39..141 CDD:238017
STKc_CAMK 163..420 CDD:270687 36/151 (24%)
S_TKc 164..421 CDD:214567 36/151 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.