DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Camk4

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_036859.2 Gene:Camk4 / 25050 RGDID:2264 Length:474 Species:Rattus norvegicus


Alignment Length:155 Identity:41/155 - (26%)
Similarity:65/155 - (41%) Gaps:49/155 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EANMASQALRELTDGEDK-DPI-TKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGI 86
            |:|.||...:...||:|| ||: .|::           .|...|.:|..|:..|..:||      
  Rat   347 ESNKASSEAQPAQDGKDKTDPLENKMQ-----------AGDHEAAKAAADETMKLQSEE------ 394

  Fly    87 RDTGLDVSEEE-IKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVIT 150
                  |.||| :|:.....:|:...|        ::.|..|:.||...||   :|.|:.:    
  Rat   395 ------VEEEEGVKEEEEEEEEEEETS--------RMVPQEPEDRLETDDQ---EMKRNSE---- 438

  Fly   151 IQDLKNVYSVKEHPKYQSGEKSEDE 175
             :.||   ||:|    :...|:|:|
  Rat   439 -ETLK---SVEE----EMDPKAEEE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/57 (23%)
EFh 64..119 CDD:238008 13/55 (24%)
EFh 97..154 CDD:238008 12/57 (21%)
EF-hand_7 98..158 CDD:290234 13/59 (22%)
EF-hand_7 134..204 CDD:290234 12/42 (29%)
Camk4NP_036859.2 STKc_CaMKIV 38..331 CDD:270987
Autoinhibitory domain 297..336
PP2A-binding. /evidence=ECO:0000250 302..319
Calmodulin-binding. /evidence=ECO:0000255 318..337
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..474 41/155 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.