DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and Dclk3

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_766516.2	Gene:	Dclk3 / 245038	MGIID:	3039580	Length:	790	Species:	Mus musculus

Alignment Length:	131	Identity:	28/131 - (21%)
Similarity:	58/131 - (44%)	Gaps:	11/131 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    61 GLGRAFRAMDDDGSKALNEE--EFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLR 123
            |||.. ||.:.:..:.|.|:  |..:|.:.....:...::::.:......|.|:. .|....:.|
Mouse   472 GLGER-RAPEKESKRKLEEKRPERPSGRKPRPKGIISADVEKHYDIGGVIGDGNF-ATVKECRHR 534

  Fly   124 PPMPQSRLNIID--QAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEG 186
            .......:.:||  |...|.|..:..::.||.|.:...||.|..|::  ::|..::.:::   :|
Mouse   535 ETKQAYAMKMIDKSQLKGKEDIVDSEILIIQSLSHPNIVKLHEVYET--EAEIYLIMEYV---QG 594

  Fly   187 G 187
            |
Mouse   595 G 595

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	11/58 (19%)
		EFh	64..119	CDD:238008	9/56 (16%)
		EFh	97..154	CDD:238008	11/58 (19%)
		EF-hand_7	98..158	CDD:290234	12/61 (20%)
		EF-hand_7	134..204	CDD:290234	15/56 (27%)
Dclk3	NP_766516.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..37
		UBQ	92..177	CDD:294102
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..290
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	315..506		9/34 (26%)
		PKc_like	513..770	CDD:304357	19/89 (21%)
		S_TKc	514..771	CDD:214567	19/88 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900