DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Camkv

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_663596.1 Gene:Camkv / 235604 MGIID:2384296 Length:512 Species:Mus musculus


Alignment Length:180 Identity:37/180 - (20%)
Similarity:62/180 - (34%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDD--------------DGSKALNEEEFIT 84
            |:||..|...:.|....|            ..|||.|.              ||.|.....:...
Mouse    19 EVTDRYDLGQVIKTEEFC------------EIFRAKDKTTGKLHTCKKFQKRDGRKVRKAAKNEI 71

  Fly    85 GIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLN-IIDQAFNKMDRDEDGV 148
            ||...   |....|.|:...|       :...|:.:.|.....:...: |:||.:.. :||...|
Mouse    72 GILKM---VKHPNILQLVDVF-------VTRKEYFIFLELATGREVFDWILDQGYYS-ERDTSNV 125

  Fly   149 I--TIQDLKNVYSVK--------EHPKYQSGEKSEDEILTDF-LHNFEGG 187
            :  .::.:..::|:|        |:..|.:..|:...:::|| |...|.|
Mouse   126 VRQVLEAVAYLHSLKIVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/70 (20%)
EFh 64..119 CDD:238008 14/68 (21%)
EFh 97..154 CDD:238008 11/59 (19%)
EF-hand_7 98..158 CDD:290234 11/62 (18%)
EF-hand_7 134..204 CDD:290234 15/65 (23%)
CamkvNP_663596.1 STKc_CaMK_like 22..286 CDD:270990 35/177 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..512
DUF5585 397..>511 CDD:375359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.