DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and Mylk2

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_001074513.2	Gene:	Mylk2 / 228785	MGIID:	2139434	Length:	613	Species:	Mus musculus

Alignment Length:	137	Identity:	31/137 - (22%)
Similarity:	45/137 - (32%)	Gaps:	48/137 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly    82 FITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKL------RPPMPQSRLNI------- 133
            |:..:|...||:..|.|.            .:|.|..|:|:      |...|..:|.:
Mouse   413 FMHKMRVLHLDLKPENIL------------CVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEF 465

  Fly   134 -------IDQAFNKMDRDEDGVIT---------------IQDLKNVYSVKEHPKYQSGEKSEDEI 176
                   .||..:|.|....||||               .:.|.||.|...:...::.|...||
Mouse   466 LSPEVVNYDQISDKTDMWSLGVITYMLLSGLSPFLGDDDTETLNNVLSANWYFDEETFEAVSDE- 529

  Fly   177 LTDFLHN 183
            ..||:.|
Mouse   530 AKDFVSN 536

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	8/36 (22%)
		EFh	64..119	CDD:238008	8/36 (22%)
		EFh	97..154	CDD:238008	16/91 (18%)
		EF-hand_7	98..158	CDD:290234	18/94 (19%)
		EF-hand_7	134..204	CDD:290234	18/65 (28%)
Mylk2	NP_001074513.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..168
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	219..240
		STKc_MLCK2	298..557	CDD:271092	31/137 (23%)
		S_TKc	308..557	CDD:214567	31/137 (23%)
		Calmodulin-binding. /evidence=ECO:0000250	591..603
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900