DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and Camk1g

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_011237234.1 Gene:Camk1g / 215303 MGIID:2388073 Length:491 Species:Mus musculus


Alignment Length:96 Identity:21/96 - (21%)
Similarity:39/96 - (40%) Gaps:20/96 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IKQMFATFDEDGSGSINMTEFLLKLR-----------PPMPQSRLNIIDQAFNKMDR-DEDGVIT 150
            |::.|...:..|||:.:.. ||:|.|           ...|..|.:.::.....:.| ..:.::|
Mouse    19 IRKTFIFMEVLGSGAFSEV-FLVKQRVTGKLFALKCIKKSPAFRDSSLENEIAVLKRIKHENIVT 82

  Fly   151 IQDLKNVYSVKEH----PKYQSGEKSEDEIL 177
            ::|   :|....|    .:..||.:..|.||
Mouse    83 LED---IYESTTHYYLVMQLVSGGELFDRIL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 5/20 (25%)
EFh 64..119 CDD:238008 5/20 (25%)
EFh 97..154 CDD:238008 13/67 (19%)
EF-hand_7 98..158 CDD:290234 14/71 (20%)
EF-hand_7 134..204 CDD:290234 10/49 (20%)
Camk1gXP_011237234.1 STKc_CaMKI_gamma 19..317 CDD:271068 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.