DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and dapk-1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_490840.2 Gene:dapk-1 / 187322 WormBaseID:WBGene00003400 Length:1425 Species:Caenorhabditis elegans


Alignment Length:165 Identity:31/165 - (18%)
Similarity:46/165 - (27%) Gaps:81/165 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASQALRELTDG--EDKDPITKLRLLCLS--------------------------------RGATG 58
            ||::.|.:.||  :::|.:....|:|..                                .|||.
 Worm   332 ASKSSRRIGDGRFDEEDMVASCTLICAEEGNLRALHKLSALHKLLPNATRKSLKSSFSEPNGATA 396

  Fly    59 I-----LGLGRAFR----------AMDDDGSKAL----------------NEEEFITGIRDTG-- 90
            :     .|....|.          |.||:|...|                ||:..:..|..||  
 Worm   397 MHCAAKYGHAEVFNYFHMKGGNICARDDNGDTPLHVACRFAQHTVAGYVANEKIDVDSINKTGET 461

  Fly    91 -LDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRP 124
             |..:.|             |....:...||:|||
 Worm   462 ALHCAVE-------------SADTRVVRLLLQLRP 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/85 (16%)
EFh 64..119 CDD:238008 14/83 (17%)
EFh 97..154 CDD:238008 6/28 (21%)
EF-hand_7 98..158 CDD:290234 6/27 (22%)
EF-hand_7 134..204 CDD:290234
dapk-1NP_490840.2 PKc_like 25..289 CDD:304357
S_TKc 28..289 CDD:214567
Ank_2 356..456 CDD:289560 13/99 (13%)
ANK 392..512 CDD:238125 23/105 (22%)
ANK repeat 392..423 CDD:293786 6/30 (20%)
ANK repeat 425..456 CDD:293786 4/30 (13%)
ANK 453..578 CDD:238125 11/44 (25%)
ANK repeat 491..522 CDD:293786
Ank_2 496..588 CDD:289560
ANK 521..644 CDD:238125
ANK repeat 524..555 CDD:293786
ANK repeat 557..588 CDD:293786
Ank_2 562..653 CDD:289560
ANK repeat 590..653 CDD:293786
P-loop_NTPase 777..>895 CDD:304359
Death_DAPK1 1304..1386 CDD:260052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.