DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and mlck-1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_509689.1 Gene:mlck-1 / 181217 WormBaseID:WBGene00013869 Length:1211 Species:Caenorhabditis elegans


Alignment Length:195 Identity:35/195 - (17%)
Similarity:69/195 - (35%) Gaps:47/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YTLEANMASQALRELTDGEDK---DPITKL-----RLLCLSRGATG--ILGLGRAFRAMDDDGSK 75
            :.:|.|....:|:........   ||:.|:     :.:..:.|..|  ..|||...:...|...|
 Worm   345 FLIEMNRLRNSLKTRMSANGHKFFDPLLKMAEKKEQKISNAIGTAGCPASGLGSLVKMAVDSQKK 409

  Fly    76 ALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLK-----------LRPPMPQ- 128
              |.:..:|...:...:..:||.|:.....:.|||.....|..:.|           |||| |: 
 Worm   410 --NGDVPVTQDANMSTEPEKEEKKKKKKIANADGSTKTEKTSSVKKKKLVETDGDAGLRPP-PEL 471

  Fly   129 -------------------SRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSED 174
                               ..|.:::   |........:.::::.|.:.:.|:...|::.|.:|:
 Worm   472 MTKRASTGGESLLAAVKVLKNLEVVE---NGNSPKRKSLCSVKEEKEIPAKKQTEGYKTLETTEN 533

  Fly   175  174
             Worm   534  533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/56 (23%)
EFh 64..119 CDD:238008 11/54 (20%)
EFh 97..154 CDD:238008 14/87 (16%)
EF-hand_7 98..158 CDD:290234 14/90 (16%)
EF-hand_7 134..204 CDD:290234 6/41 (15%)
mlck-1NP_509689.1 PKc_like 51..300 CDD:389743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.