DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and cmk-1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_500139.1 Gene:cmk-1 / 176989 WormBaseID:WBGene00000553 Length:348 Species:Caenorhabditis elegans


Alignment Length:186 Identity:39/186 - (20%)
Similarity:56/186 - (30%) Gaps:69/186 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DGEDKDPITKLRLLCLSRGATGILGLGRAFRA--MDDDG---------SKALNEEEFITGIRDTG 90
            ||....|...:|.....|...|.....:.|.|  ..|.|         .|||..:|         
 Worm     8 DGSGPAPNATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKE--------- 63

  Fly    91 LDVSEEEIK-----------QMFATFDED--------------------GSGSINMTEFLLKLRP 124
             :..|.|||           |:|.|:||.                    ..||  .||       
 Worm    64 -ESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGS--YTE------- 118

  Fly   125 PMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDF 180
               |...|:|.|....:....|..:..:|||     .|:..|.:.::....:::||
 Worm   119 ---QDASNLIRQVLEAVGFMHDNGVVHRDLK-----PENLLYYNQDEDSKIMISDF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 21/98 (21%)
EFh 64..119 CDD:238008 21/96 (22%)
EFh 97..154 CDD:238008 17/87 (20%)
EF-hand_7 98..158 CDD:290234 19/90 (21%)
EF-hand_7 134..204 CDD:290234 10/47 (21%)
cmk-1NP_500139.1 STKc_CaMKI 18..277 CDD:270985 36/176 (20%)
S_TKc 22..278 CDD:214567 35/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.