DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and zyg-8

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_499571.2 Gene:zyg-8 / 176639 WormBaseID:WBGene00006993 Length:802 Species:Caenorhabditis elegans


Alignment Length:274 Identity:56/274 - (20%)
Similarity:96/274 - (35%) Gaps:92/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PNCDLYTLEANMASQALRELTDG-------EDKDPITKLRLLCLSRGATGILGLGRAFR------ 67
            ||....|.||:|.|......|:|       |.:|.:::::..| ..|.:|...|.:|.|      
 Worm   155 PNSGTNTAEASMTSSVCAMETEGTNGDELAESRDMVSEMQRRC-RIGPSGYPHLLKAKRLRFYRN 218

  Fly    68 ----------AMDDDGSKA---LNEEEFITGIRD-TGLDVSEEEIKQMFATFD-----------E 107
                      |:..|..|:   |.|:...|.|.| |.|   ...|:.:| |.|           |
 Worm   219 GDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTAL---PHGIRHIF-TIDGAQRITSVDQFE 279

  Fly   108 DGSGSINMTEFLLKLRPPMPQSR------------------------LNIIDQAFNKMDRDEDGV 148
            ||.|.:..:....|   |:..||                        |::::......|.....:
 Worm   280 DGGGYVCSSTDAFK---PVDYSRAAEPSWRLTLANRYNRHLETKKLALSVVEPCHENTDFVFPRI 341

  Fly   149 ITIQDLKNVYS---VKEHPKYQSGEKSEDEILTD--FLHNFEGGR----GNLDGK--ITREEFVN 202
            |.:  ::|...   :..|...:...:|.|::|.|  |:...:.|.    ..|.|:  ::.::|..
 Worm   342 IKV--IRNGVKPRRISRHLLNKKTARSFDQVLRDLTFVVKLDSGAIRKLFTLSGRPVLSLQDFFR 404

  Fly   203 YYATISASIDNDMF 216
                     |:|:|
 Worm   405 ---------DDDVF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 21/87 (24%)
EFh 64..119 CDD:238008 20/85 (24%)
EFh 97..154 CDD:238008 15/91 (16%)
EF-hand_7 98..158 CDD:290234 16/94 (17%)
EF-hand_7 134..204 CDD:290234 13/80 (16%)
zyg-8NP_499571.2 DCX 206..298 CDD:214711 23/98 (23%)
DCX 335..423 CDD:214711 16/86 (19%)
STKc_DCKL 481..742 CDD:270997
S_TKc 482..743 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.