Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495105.1 | Gene: | F59E12.1 / 173957 | WormBaseID: | WBGene00019118 | Length: | 811 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 46/196 - (23%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 61/196 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 SQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDD-DGSKA------LNEEEFITGI 86
Fly 87 RDTGLDVSEEEIKQMFATFDEDGSGSINM-TEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVIT 150
Fly 151 IQDLKNVYSVKEHPKYQSGEKSEDEILTDFLH--NFEGGRGNLDGKITREEFVNYYATISASIDN 213
Fly 214 D 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 15/64 (23%) |
EFh | 64..119 | CDD:238008 | 15/62 (24%) | ||
EFh | 97..154 | CDD:238008 | 12/57 (21%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 12/60 (20%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 15/71 (21%) | ||
F59E12.1 | NP_495105.1 | PHA03307 | 180..>530 | CDD:223039 | |
Bromodomain | 642..744 | CDD:383021 | 32/150 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |