powered by:
Protein Alignment CG10126 and Camk1
DIOPT Version :9
Sequence 1: | NP_788664.2 |
Gene: | CG10126 / 41579 |
FlyBaseID: | FBgn0038088 |
Length: | 227 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006237061.1 |
Gene: | Camk1 / 171503 |
RGDID: | 629473 |
Length: | 414 |
Species: | Rattus norvegicus |
Alignment Length: | 45 |
Identity: | 15/45 - (33%) |
Similarity: | 21/45 - (46%) |
Gaps: | 12/45 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 MDDDGSKALNEEE-----FITGIRDTGLDVS-----EEEIKQMFA 103
|:.|..|....|: :|.| ||.||.: .|:||:.||
Rat 288 MEKDPEKRFTCEQALQHPWIAG--DTALDKNIHQSVSEQIKKNFA 330
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.